PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA030901-PA
Common NameOsI_31643
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HSF
Protein Properties Length: 98aa    MW: 10387.8 Da    PI: 8.5243
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA030901-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind773.2e-243190261
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
      HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                      Fl+k+++++e+++++e+isw ++g+sfvv+++ efa+++Lp +Fkh nf+SFvRQLn+Y+
  BGIOSGA030901-PA 31 FLTKTHQMVEESATDEVISWGKEGRSFVVWKPVEFARDLLPLHFKHCNFSSFVRQLNTYD 90
                      9**********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.102.9E-262690IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.35E-222790IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004153.8E-192798IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-133154IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004472.7E-203190IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-136981IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000562.7E-138294IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MAAAEAAAAV GKQQQKGGGG RGGGGGGPAP FLTKTHQMVE ESATDEVISW GKEGRSFVVW  60
KPVEFARDLL PLHFKHCNFS SFVRQLNTYD ALNGVLLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A3e-172489165HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A3e-172489165HEAT-SHOCK TRANSCRIPTION FACTOR
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11826GGRGGGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.271761e-146callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329863911e-146
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-148CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611859.14e-58PREDICTED: heat stress transcription factor B-1
SwissprotQ67TP95e-60HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLA2Z2091e-67A2Z209_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA030901-PA4e-67(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11660.15e-28HSF family protein